Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4468471..4469306 | Replicon | chromosome |
| Accession | NZ_CP120557 | ||
| Organism | Escherichia coli strain B771 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | P5709_RS21745 | Protein ID | WP_000854726.1 |
| Coordinates | 4468929..4469306 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1L6W4Z7 |
| Locus tag | P5709_RS21740 | Protein ID | WP_070749977.1 |
| Coordinates | 4468471..4468839 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5709_RS21710 (4463586) | 4463586..4466432 | + | 2847 | WP_094875684.1 | Ag43/Cah family autotransporter adhesin | - |
| P5709_RS21715 (4466503) | 4466503..4466698 | + | 196 | Protein_4244 | DUF905 family protein | - |
| P5709_RS21720 (4466816) | 4466816..4466977 | + | 162 | Protein_4245 | DUF945 domain-containing protein | - |
| P5709_RS21725 (4466996) | 4466996..4467472 | + | 477 | WP_001186770.1 | RadC family protein | - |
| P5709_RS21730 (4467541) | 4467541..4467762 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
| P5709_RS21735 (4467777) | 4467777..4468421 | + | 645 | Protein_4248 | antitoxin of toxin-antitoxin stability system | - |
| P5709_RS21740 (4468471) | 4468471..4468839 | + | 369 | WP_070749977.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P5709_RS21745 (4468929) | 4468929..4469306 | + | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| P5709_RS21750 (4469303) | 4469303..4469791 | + | 489 | WP_094875682.1 | DUF5983 family protein | - |
| P5709_RS21755 (4469803) | 4469803..4470000 | + | 198 | WP_000839267.1 | DUF957 domain-containing protein | - |
| P5709_RS21760 (4470085) | 4470085..4470933 | + | 849 | WP_042047262.1 | DUF4942 domain-containing protein | - |
| P5709_RS21765 (4471026) | 4471026..4472345 | - | 1320 | WP_252705308.1 | site-specific integrase | - |
| P5709_RS21770 (4472683) | 4472683..4473021 | - | 339 | Protein_4255 | LysR substrate-binding domain-containing protein | - |
| P5709_RS21775 (4473072) | 4473072..4474028 | - | 957 | WP_000122394.1 | molybdenum cofactor insertion chaperone PaoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4449722..4478906 | 29184 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T275141 WP_000854726.1 NZ_CP120557:4468929-4469306 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13860.63 Da Isoelectric Point: 6.3177
>AT275141 WP_070749977.1 NZ_CP120557:4468471-4468839 [Escherichia coli]
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQVFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
VSDTFHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQVFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGVTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1EZ92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1L6W4Z7 |