Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 2358832..2359486 | Replicon | chromosome |
Accession | NZ_CP120557 | ||
Organism | Escherichia coli strain B771 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A140N853 |
Locus tag | P5709_RS11675 | Protein ID | WP_000244783.1 |
Coordinates | 2358832..2359239 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5709_RS11680 | Protein ID | WP_000354046.1 |
Coordinates | 2359220..2359486 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5709_RS11655 (2354789) | 2354789..2356522 | - | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P5709_RS11660 (2356528) | 2356528..2357238 | - | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5709_RS11665 (2357263) | 2357263..2358159 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P5709_RS11670 (2358271) | 2358271..2358792 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
P5709_RS11675 (2358832) | 2358832..2359239 | - | 408 | WP_000244783.1 | protein YgfX | Toxin |
P5709_RS11680 (2359220) | 2359220..2359486 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5709_RS11685 (2359729) | 2359729..2360709 | + | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
P5709_RS11690 (2360905) | 2360905..2361564 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5709_RS11695 (2361728) | 2361728..2362039 | - | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
P5709_RS11700 (2362084) | 2362084..2363517 | + | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
P5709_RS11705 (2363574) | 2363574..2364317 | - | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15962.85 Da Isoelectric Point: 11.2669
>T275133 WP_000244783.1 NZ_CP120557:c2359239-2358832 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEISLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140N853 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |