Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1402369..1403200 Replicon chromosome
Accession NZ_CP120557
Organism Escherichia coli strain B771

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag P5709_RS07170 Protein ID WP_000854814.1
Coordinates 1402826..1403200 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag P5709_RS07165 Protein ID WP_001285585.1
Coordinates 1402369..1402737 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5709_RS07135 (1399273) 1399273..1399728 + 456 WP_000581504.1 IrmA family protein -
P5709_RS07140 (1399807) 1399807..1400040 + 234 WP_001119729.1 DUF905 family protein -
P5709_RS07145 (1400140) 1400140..1400958 + 819 WP_001234629.1 DUF932 domain-containing protein -
P5709_RS07150 (1401040) 1401040..1401519 + 480 WP_000860076.1 antirestriction protein -
P5709_RS07155 (1401535) 1401535..1402011 + 477 WP_001186773.1 RadC family protein -
P5709_RS07160 (1402074) 1402074..1402295 + 222 WP_000692323.1 DUF987 domain-containing protein -
P5709_RS07165 (1402369) 1402369..1402737 + 369 WP_001285585.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
P5709_RS07170 (1402826) 1402826..1403200 + 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P5709_RS07175 (1403197) 1403197..1403391 + 195 WP_000988600.1 DUF5983 family protein -
P5709_RS07180 (1403437) 1403437..1403517 + 81 Protein_1417 hypothetical protein -
P5709_RS07185 (1403806) 1403806..1403934 - 129 Protein_1418 transposase domain-containing protein -
P5709_RS07190 (1404054) 1404054..1404188 + 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
P5709_RS07195 (1404289) 1404289..1404618 - 330 WP_000450409.1 DUF496 family protein -
P5709_RS07200 (1404790) 1404790..1405848 - 1059 WP_001200891.1 FUSC family protein -
P5709_RS07205 (1406046) 1406046..1406519 - 474 WP_001105415.1 DNA gyrase inhibitor SbmC -
P5709_RS07210 (1406638) 1406638..1407804 - 1167 WP_000830156.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T275130 WP_000854814.1 NZ_CP120557:1402826-1403200 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT275130 WP_001285585.1 NZ_CP120557:1402369-1402737 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References