Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 120375..121209 | Replicon | chromosome |
Accession | NZ_CP120557 | ||
Organism | Escherichia coli strain B771 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | W0S379 |
Locus tag | P5709_RS00680 | Protein ID | WP_000854808.1 |
Coordinates | 120832..121209 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | P5709_RS00675 | Protein ID | WP_277715387.1 |
Coordinates | 120375..120743 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5709_RS00650 (117491) | 117491..118309 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
P5709_RS00655 (118400) | 118400..118885 | + | 486 | WP_000214317.1 | antirestriction protein | - |
P5709_RS00660 (118900) | 118900..119376 | + | 477 | WP_001384029.1 | RadC family protein | - |
P5709_RS00665 (119445) | 119445..119666 | + | 222 | WP_000692353.1 | DUF987 domain-containing protein | - |
P5709_RS00670 (119681) | 119681..120325 | + | 645 | WP_277715386.1 | antitoxin of toxin-antitoxin stability system | - |
P5709_RS00675 (120375) | 120375..120743 | + | 369 | WP_277715387.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P5709_RS00680 (120832) | 120832..121209 | + | 378 | WP_000854808.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
P5709_RS00685 (121206) | 121206..121694 | + | 489 | WP_039022338.1 | DUF5983 family protein | - |
P5709_RS00690 (121706) | 121706..121903 | + | 198 | WP_029396577.1 | DUF957 domain-containing protein | - |
P5709_RS00695 (121988) | 121988..122830 | + | 843 | WP_175109877.1 | DUF4942 domain-containing protein | - |
P5709_RS00705 (123322) | 123322..123540 | - | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
P5709_RS00710 (123825) | 123825..124529 | - | 705 | WP_001241678.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13909.93 Da Isoelectric Point: 7.9085
>T275120 WP_000854808.1 NZ_CP120557:120832-121209 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|