Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 131103..131746 | Replicon | plasmid pB1172_153456 |
Accession | NZ_CP120550 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | P5710_RS25620 | Protein ID | WP_001034044.1 |
Coordinates | 131330..131746 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | P5710_RS25615 | Protein ID | WP_001261286.1 |
Coordinates | 131103..131333 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS25600 (P5710_25600) | 126240..126470 | + | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
P5710_RS25605 (P5710_25605) | 126467..126883 | + | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
P5710_RS25610 (P5710_25610) | 126928..130722 | - | 3795 | WP_001144732.1 | hypothetical protein | - |
P5710_RS25615 (P5710_25615) | 131103..131333 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
P5710_RS25620 (P5710_25620) | 131330..131746 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P5710_RS25625 (P5710_25625) | 131821..133386 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
P5710_RS25630 (P5710_25630) | 133371..134393 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / vat / iutA / iucD / iucC / iucB / iucA | 1..153456 | 153456 | |
- | flank | IS/Tn | - | - | 134647..135150 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T275119 WP_001034044.1 NZ_CP120550:131330-131746 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |