Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 126240..126883 Replicon plasmid pB1172_153456
Accession NZ_CP120550
Organism Escherichia coli strain B1172

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag P5710_RS25605 Protein ID WP_001034046.1
Coordinates 126467..126883 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag P5710_RS25600 Protein ID WP_001261278.1
Coordinates 126240..126470 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5710_RS25580 (P5710_25580) 122777..123532 - 756 WP_000852146.1 replication initiation protein RepE -
P5710_RS25585 (P5710_25585) 124320..125126 - 807 WP_000016982.1 site-specific integrase -
P5710_RS25590 (P5710_25590) 125127..125432 - 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -
P5710_RS25595 (P5710_25595) 125434..125652 - 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
P5710_RS25600 (P5710_25600) 126240..126470 + 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P5710_RS25605 (P5710_25605) 126467..126883 + 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
P5710_RS25610 (P5710_25610) 126928..130722 - 3795 WP_001144732.1 hypothetical protein -
P5710_RS25615 (P5710_25615) 131103..131333 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
P5710_RS25620 (P5710_25620) 131330..131746 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iroB / iroC / iroD / iroE / iroN / vat / vat / iutA / iucD / iucC / iucB / iucA 1..153456 153456


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T275118 WP_001034046.1 NZ_CP120550:126467-126883 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT275118 WP_001261278.1 NZ_CP120550:126240-126470 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References