Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 83795..84420 | Replicon | plasmid pB1172_153456 |
| Accession | NZ_CP120550 | ||
| Organism | Escherichia coli strain B1172 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P5710_RS25325 | Protein ID | WP_000911313.1 |
| Coordinates | 84022..84420 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | P5710_RS25320 | Protein ID | WP_000450520.1 |
| Coordinates | 83795..84022 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5710_RS25320 (P5710_25320) | 83795..84022 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P5710_RS25325 (P5710_25325) | 84022..84420 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P5710_RS25330 (P5710_25330) | 84429..86582 | - | 2154 | WP_053879280.1 | type IV conjugative transfer system coupling protein TraD | - |
| P5710_RS25335 (P5710_25335) | 86834..87565 | - | 732 | WP_000850423.1 | conjugal transfer complement resistance protein TraT | - |
| P5710_RS25340 (P5710_25340) | 87579..88088 | - | 510 | WP_000628105.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iroB / iroC / iroD / iroE / iroN / vat / vat / iutA / iucD / iucC / iucB / iucA | 1..153456 | 153456 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T275116 WP_000911313.1 NZ_CP120550:84022-84420 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|