Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4583598..4584399 | Replicon | chromosome |
Accession | NZ_CP120549 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | P5710_RS22260 | Protein ID | WP_001094436.1 |
Coordinates | 4584022..4584399 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | P5710_RS22255 | Protein ID | WP_015953067.1 |
Coordinates | 4583598..4583975 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS22220 (4579510) | 4579510..4580190 | + | 681 | WP_001282927.1 | WYL domain-containing protein | - |
P5710_RS22225 (4580338) | 4580338..4581015 | + | 678 | WP_001097312.1 | hypothetical protein | - |
P5710_RS22230 (4581021) | 4581021..4581254 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
P5710_RS22235 (4581344) | 4581344..4582162 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
P5710_RS22240 (4582253) | 4582253..4582738 | + | 486 | WP_000860054.1 | antirestriction protein | - |
P5710_RS22245 (4582753) | 4582753..4583229 | + | 477 | WP_001186756.1 | RadC family protein | - |
P5710_RS22250 (4583298) | 4583298..4583519 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
P5710_RS22255 (4583598) | 4583598..4583975 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
P5710_RS22260 (4584022) | 4584022..4584399 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
P5710_RS22265 (4584396) | 4584396..4584884 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
P5710_RS22270 (4584896) | 4584896..4585093 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
P5710_RS22275 (4585178) | 4585178..4586023 | + | 846 | WP_001280513.1 | DUF4942 domain-containing protein | - |
P5710_RS22280 (4586094) | 4586094..4587629 | + | 1536 | WP_000492897.1 | EAL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T275113 WP_001094436.1 NZ_CP120549:4584022-4584399 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT275113 WP_015953067.1 NZ_CP120549:4583598-4583975 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |