Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3652566..3653184 | Replicon | chromosome |
Accession | NZ_CP120549 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P5710_RS17675 | Protein ID | WP_001291435.1 |
Coordinates | 3652966..3653184 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P5710_RS17670 | Protein ID | WP_000344800.1 |
Coordinates | 3652566..3652940 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS17660 (3647656) | 3647656..3648849 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P5710_RS17665 (3648872) | 3648872..3652021 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
P5710_RS17670 (3652566) | 3652566..3652940 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P5710_RS17675 (3652966) | 3652966..3653184 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P5710_RS17680 (3653358) | 3653358..3653909 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
P5710_RS17685 (3654025) | 3654025..3654495 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P5710_RS17690 (3654659) | 3654659..3656209 | + | 1551 | WP_001298569.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P5710_RS17695 (3656251) | 3656251..3656604 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
P5710_RS17705 (3656983) | 3656983..3657294 | + | 312 | WP_000409908.1 | MGMT family protein | - |
P5710_RS17710 (3657325) | 3657325..3657897 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275108 WP_001291435.1 NZ_CP120549:3652966-3653184 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275108 WP_000344800.1 NZ_CP120549:3652566-3652940 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |