Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1959568..1960399 Replicon chromosome
Accession NZ_CP120549
Organism Escherichia coli strain B1172

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag P5710_RS09305 Protein ID WP_000854814.1
Coordinates 1959568..1959942 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A366YXM1
Locus tag P5710_RS09310 Protein ID WP_001518724.1
Coordinates 1960031..1960399 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5710_RS09265 (1954964) 1954964..1956130 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
P5710_RS09270 (1956249) 1956249..1956722 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
P5710_RS09275 (1956920) 1956920..1957978 + 1059 WP_001200894.1 FUSC family protein -
P5710_RS09280 (1958150) 1958150..1958479 + 330 WP_000450409.1 DUF496 family protein -
P5710_RS09285 (1958580) 1958580..1958714 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
P5710_RS09290 (1958816) 1958816..1958962 + 147 Protein_1820 transposase domain-containing protein -
P5710_RS09295 (1959251) 1959251..1959331 - 81 Protein_1821 hypothetical protein -
P5710_RS09300 (1959377) 1959377..1959571 - 195 WP_000988601.1 DUF5983 family protein -
P5710_RS09305 (1959568) 1959568..1959942 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P5710_RS09310 (1960031) 1960031..1960399 - 369 WP_001518724.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
P5710_RS09315 (1960473) 1960473..1960694 - 222 WP_000692323.1 DUF987 domain-containing protein -
P5710_RS09320 (1960757) 1960757..1961233 - 477 WP_001186773.1 RadC family protein -
P5710_RS09325 (1961249) 1961249..1961722 - 474 WP_000855075.1 antirestriction protein -
P5710_RS09330 (1961985) 1961985..1962806 - 822 WP_001234710.1 DUF932 domain-containing protein -
P5710_RS09335 (1963027) 1963027..1963437 - 411 WP_000846705.1 hypothetical protein -
P5710_RS09340 (1963453) 1963453..1964106 - 654 WP_001518719.1 hypothetical protein -
P5710_RS09345 (1964199) 1964199..1965376 + 1178 WP_152895938.1 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T275101 WP_000854814.1 NZ_CP120549:c1959942-1959568 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13441.24 Da        Isoelectric Point: 4.7594

>AT275101 WP_001518724.1 NZ_CP120549:c1960399-1960031 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYPLDQAFPLLMKQLELMLTSG
ELNPRNQHTVTLYAKGLACEADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A366YXM1

References