Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 999087..999741 | Replicon | chromosome |
Accession | NZ_CP120549 | ||
Organism | Escherichia coli strain B1172 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | P5710_RS04875 | Protein ID | WP_000244781.1 |
Coordinates | 999334..999741 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5710_RS04870 | Protein ID | WP_000354046.1 |
Coordinates | 999087..999353 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5710_RS04850 (995175) | 995175..996608 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
P5710_RS04855 (996653) | 996653..996964 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
P5710_RS04860 (997128) | 997128..997787 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5710_RS04865 (997864) | 997864..998844 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
P5710_RS04870 (999087) | 999087..999353 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5710_RS04875 (999334) | 999334..999741 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
P5710_RS04880 (999781) | 999781..1000302 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P5710_RS04885 (1000414) | 1000414..1001310 | + | 897 | WP_000806633.1 | site-specific tyrosine recombinase XerD | - |
P5710_RS04890 (1001335) | 1001335..1002045 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5710_RS04895 (1002051) | 1002051..1003784 | + | 1734 | WP_000813193.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275098 WP_000244781.1 NZ_CP120549:999334-999741 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|