Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 817797..818629 | Replicon | chromosome |
| Accession | NZ_CP120549 | ||
| Organism | Escherichia coli strain B1172 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | P5710_RS03965 | Protein ID | WP_000854753.1 |
| Coordinates | 817797..818171 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | P5710_RS03970 | Protein ID | WP_001278232.1 |
| Coordinates | 818261..818629 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5710_RS03935 (812911) | 812911..814059 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| P5710_RS03940 (814131) | 814131..815114 | - | 984 | WP_001331698.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| P5710_RS03945 (815925) | 815925..816095 | - | 171 | Protein_775 | IS110 family transposase | - |
| P5710_RS03950 (816437) | 816437..817006 | - | 570 | WP_001290241.1 | DUF4942 domain-containing protein | - |
| P5710_RS03955 (817103) | 817103..817300 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| P5710_RS03960 (817312) | 817312..817800 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| P5710_RS03965 (817797) | 817797..818171 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| P5710_RS03970 (818261) | 818261..818629 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| P5710_RS03975 (818792) | 818792..819013 | - | 222 | WP_000692316.1 | DUF987 domain-containing protein | - |
| P5710_RS03980 (819076) | 819076..819552 | - | 477 | WP_001186726.1 | RadC family protein | - |
| P5710_RS03985 (819568) | 819568..820053 | - | 486 | WP_001520165.1 | antirestriction protein | - |
| P5710_RS03990 (820108) | 820108..820926 | - | 819 | WP_001520163.1 | DUF932 domain-containing protein | - |
| P5710_RS03995 (821026) | 821026..821259 | - | 234 | WP_001119729.1 | DUF905 family protein | - |
| P5710_RS04000 (821338) | 821338..821793 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T275097 WP_000854753.1 NZ_CP120549:c818171-817797 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT275097 WP_001278232.1 NZ_CP120549:c818629-818261 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |