Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yfjZ/CbtA-CbeA
Location 4074675..4075354 Replicon chromosome
Accession NZ_CP120524
Organism Enterobacter roggenkampii strain 0-E

Toxin (Protein)


Gene name ykfI Uniprot ID -
Locus tag P3S52_RS20860 Protein ID WP_014641112.1
Coordinates 4074675..4075016 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yfjZ Uniprot ID -
Locus tag P3S52_RS20865 Protein ID WP_001004647.1
Coordinates 4075037..4075354 (-) Length 106 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P3S52_RS20815 (P3S52_20840) 4069953..4070186 - 234 WP_103822926.1 DUF2732 family protein -
P3S52_RS20820 (P3S52_20845) 4070253..4070654 - 402 WP_277592254.1 hypothetical protein -
P3S52_RS20825 (P3S52_20850) 4070654..4071082 - 429 WP_234600517.1 hypothetical protein -
P3S52_RS20830 (P3S52_20855) 4071072..4071269 - 198 WP_234600518.1 DUF2724 domain-containing protein -
P3S52_RS20835 (P3S52_20860) 4071279..4071782 - 504 WP_103177081.1 phage regulatory CII family protein -
P3S52_RS20840 (P3S52_20865) 4071813..4072033 - 221 Protein_3846 regulator -
P3S52_RS20845 (P3S52_20870) 4072177..4072758 + 582 WP_103177082.1 phage repressor protein CI -
P3S52_RS20850 (P3S52_20875) 4072775..4073341 + 567 WP_234600519.1 PH domain-containing protein -
P3S52_RS20855 (P3S52_20880) 4073345..4074382 + 1038 WP_277592255.1 tyrosine-type recombinase/integrase -
P3S52_RS20860 (P3S52_20885) 4074675..4075016 - 342 WP_014641112.1 TA system toxin CbtA family protein Toxin
P3S52_RS20865 (P3S52_20890) 4075037..4075354 - 318 WP_001004647.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P3S52_RS20870 (P3S52_20895) 4075383..4075865 - 483 WP_180837426.1 DNA repair protein RadC -
P3S52_RS20875 (P3S52_20900) 4075874..4076332 - 459 WP_000211839.1 antirestriction protein -
P3S52_RS20880 (P3S52_20905) 4076434..4076673 - 240 WP_001115184.1 DUF905 domain-containing protein -
P3S52_RS20885 (P3S52_20910) 4076764..4080231 - 3468 WP_277592256.1 AIDA repeat-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - kpsF / kpsE 4040477..4086571 46094


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(5-104)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13031.28 Da        Isoelectric Point: 10.5786

>T275095 WP_014641112.1 NZ_CP120524:c4075016-4074675 [Enterobacter roggenkampii]
MKTLPATTLRVVKPCLSPVAVWKMLLTRLLEQHYGLTLNDTPFSKERVIQEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAVDILRARQATGLLRQSRKNLVR

Download         Length: 342 bp

Antitoxin


Download         Length: 106 a.a.        Molecular weight: 12111.73 Da        Isoelectric Point: 6.6252

>AT275095 WP_001004647.1 NZ_CP120524:c4075354-4075037 [Enterobacter roggenkampii]
VNEMTWGLQRDVTPRFGVRLVQESNRLHYLSDRASITGKFSDVECLRLDEAFPHFVRQMELMLTTGDLNPRHTHCVTLYH
NGFTCEADTLGSCGYVYIAIYPTQR

Download         Length: 318 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References