Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3879755..3880412 | Replicon | chromosome |
Accession | NZ_CP120524 | ||
Organism | Enterobacter roggenkampii strain 0-E |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | P3S52_RS19840 | Protein ID | WP_032653292.1 |
Coordinates | 3879755..3880165 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W7NX65 |
Locus tag | P3S52_RS19845 | Protein ID | WP_006178375.1 |
Coordinates | 3880146..3880412 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3S52_RS19820 (P3S52_19840) | 3875748..3877481 | - | 1734 | WP_032653290.1 | single-stranded-DNA-specific exonuclease RecJ | - |
P3S52_RS19825 (P3S52_19845) | 3877487..3878200 | - | 714 | WP_008499708.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P3S52_RS19830 (P3S52_19850) | 3878229..3879125 | - | 897 | WP_008499709.1 | site-specific tyrosine recombinase XerD | - |
P3S52_RS19835 (P3S52_19855) | 3879227..3879748 | + | 522 | WP_023309099.1 | flavodoxin FldB | - |
P3S52_RS19840 (P3S52_19860) | 3879755..3880165 | - | 411 | WP_032653292.1 | protein YgfX | Toxin |
P3S52_RS19845 (P3S52_19865) | 3880146..3880412 | - | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
P3S52_RS19850 (P3S52_19870) | 3880707..3881687 | + | 981 | WP_032653295.1 | tRNA-modifying protein YgfZ | - |
P3S52_RS19855 (P3S52_19875) | 3881772..3882431 | - | 660 | WP_032653297.1 | hemolysin III family protein | - |
P3S52_RS19860 (P3S52_19880) | 3882697..3883428 | + | 732 | WP_021242053.1 | MurR/RpiR family transcriptional regulator | - |
P3S52_RS19865 (P3S52_19885) | 3883545..3884978 | + | 1434 | WP_023294510.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16069.03 Da Isoelectric Point: 10.9468
>T275094 WP_032653292.1 NZ_CP120524:c3880165-3879755 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKADGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKADGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|