Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1096059..1096679 | Replicon | chromosome |
Accession | NZ_CP120524 | ||
Organism | Enterobacter roggenkampii strain 0-E |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A1H8SI38 |
Locus tag | P3S52_RS06315 | Protein ID | WP_008499287.1 |
Coordinates | 1096059..1096277 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V3PBI9 |
Locus tag | P3S52_RS06320 | Protein ID | WP_008499288.1 |
Coordinates | 1096305..1096679 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3S52_RS06285 (P3S52_06295) | 1092072..1092332 | + | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
P3S52_RS06290 (P3S52_06300) | 1092335..1092475 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
P3S52_RS06295 (P3S52_06305) | 1092472..1093182 | - | 711 | WP_032656573.1 | GNAT family protein | - |
P3S52_RS06300 (P3S52_06310) | 1093284..1094744 | + | 1461 | WP_032656575.1 | PLP-dependent aminotransferase family protein | - |
P3S52_RS06305 (P3S52_06315) | 1094716..1095183 | - | 468 | WP_008499285.1 | YlaC family protein | - |
P3S52_RS06310 (P3S52_06320) | 1095301..1095852 | - | 552 | WP_008499286.1 | maltose O-acetyltransferase | - |
P3S52_RS06315 (P3S52_06325) | 1096059..1096277 | - | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
P3S52_RS06320 (P3S52_06330) | 1096305..1096679 | - | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
P3S52_RS06325 (P3S52_06335) | 1097188..1100334 | - | 3147 | WP_200448353.1 | multidrug efflux RND transporter permease subunit AcrB | - |
P3S52_RS06330 (P3S52_06340) | 1100357..1101550 | - | 1194 | WP_021241633.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T275088 WP_008499287.1 NZ_CP120524:c1096277-1096059 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT275088 WP_008499288.1 NZ_CP120524:c1096679-1096305 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1H8SI38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V3PBI9 |