Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 125719..126245 | Replicon | plasmid pER0-E1 |
Accession | NZ_CP120521 | ||
Organism | Enterobacter roggenkampii strain 0-E |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | P3S52_RS00625 | Protein ID | WP_000323025.1 |
Coordinates | 125719..126006 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | P3S52_RS00630 | Protein ID | WP_004196370.1 |
Coordinates | 126006..126245 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3S52_RS00590 (P3S52_00590) | 121296..121589 | - | 294 | WP_057061548.1 | hypothetical protein | - |
P3S52_RS00595 (P3S52_00595) | 122280..122615 | - | 336 | WP_045409790.1 | hypothetical protein | - |
P3S52_RS00600 (P3S52_00600) | 122659..123450 | - | 792 | WP_045409787.1 | N-6 DNA methylase | - |
P3S52_RS00605 (P3S52_00605) | 123491..123691 | - | 201 | WP_031494497.1 | hypothetical protein | - |
P3S52_RS00610 (P3S52_00610) | 123779..124240 | - | 462 | WP_052672942.1 | DUF1419 domain-containing protein | - |
P3S52_RS00615 (P3S52_00615) | 124298..124613 | - | 316 | Protein_122 | hypothetical protein | - |
P3S52_RS00620 (P3S52_00620) | 125493..125666 | - | 174 | WP_236593106.1 | DUF5431 family protein | - |
P3S52_RS00625 (P3S52_00625) | 125719..126006 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
P3S52_RS00630 (P3S52_00630) | 126006..126245 | - | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
P3S52_RS00635 (P3S52_00635) | 126270..126368 | + | 99 | Protein_126 | protein YdfV | - |
P3S52_RS00640 (P3S52_00640) | 126496..126861 | + | 366 | WP_009651956.1 | hypothetical protein | - |
P3S52_RS00645 (P3S52_00645) | 126905..127642 | + | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
P3S52_RS00650 (P3S52_00650) | 127656..128345 | + | 690 | WP_004196322.1 | hypothetical protein | - |
P3S52_RS00655 (P3S52_00655) | 128376..129752 | - | 1377 | WP_004196363.1 | chromate efflux transporter | - |
P3S52_RS00660 (P3S52_00660) | 129709..130686 | - | 978 | WP_004196334.1 | chromate resistance protein | - |
P3S52_RS00665 (P3S52_00665) | 130716..130908 | + | 193 | Protein_132 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | mrkA / mrkB / mrkC / mrkD / mrkF / mrkJ | 1..157085 | 157085 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T275085 WP_000323025.1 NZ_CP120521:c126006-125719 [Enterobacter roggenkampii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|