Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1381760..1382676 | Replicon | chromosome |
Accession | NZ_CP120511 | ||
Organism | Bacillus sp. B28 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A7G7U9Y2 |
Locus tag | P3L57_RS06950 | Protein ID | WP_024121091.1 |
Coordinates | 1381930..1382676 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | P3L57_RS06945 | Protein ID | WP_024121090.1 |
Coordinates | 1381760..1381930 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3L57_RS06905 (P3L57_06905) | 1377128..1377400 | + | 273 | WP_044156234.1 | hypothetical protein | - |
P3L57_RS06910 (P3L57_06910) | 1377403..1379370 | + | 1968 | WP_069486429.1 | pyocin knob domain-containing protein | - |
P3L57_RS06915 (P3L57_06915) | 1379384..1379773 | + | 390 | WP_059336104.1 | hypothetical protein | - |
P3L57_RS06920 (P3L57_06920) | 1379774..1379914 | + | 141 | WP_059336103.1 | XkdX family protein | - |
P3L57_RS06925 (P3L57_06925) | 1380043..1380321 | + | 279 | WP_059336102.1 | hemolysin XhlA family protein | - |
P3L57_RS06930 (P3L57_06930) | 1380333..1380596 | + | 264 | WP_024121086.1 | phage holin | - |
P3L57_RS06935 (P3L57_06935) | 1380609..1381502 | + | 894 | WP_059336101.1 | N-acetylmuramoyl-L-alanine amidase | - |
P3L57_RS06940 (P3L57_06940) | 1381539..1381676 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P3L57_RS06945 (P3L57_06945) | 1381760..1381930 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
P3L57_RS06950 (P3L57_06950) | 1381930..1382676 | - | 747 | WP_024121091.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P3L57_RS06955 (P3L57_06955) | 1382785..1383786 | - | 1002 | WP_044156221.1 | inorganic phosphate transporter | - |
P3L57_RS06960 (P3L57_06960) | 1383799..1384416 | - | 618 | WP_044156219.1 | DUF47 domain-containing protein | - |
P3L57_RS06965 (P3L57_06965) | 1384694..1386010 | - | 1317 | WP_059336100.1 | serine/threonine exchanger | - |
P3L57_RS06970 (P3L57_06970) | 1386405..1387355 | + | 951 | WP_069486430.1 | ring-cleaving dioxygenase | - |
P3L57_RS06975 (P3L57_06975) | 1387521..1387601 | + | 81 | Protein_1310 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1347597..1391118 | 43521 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29076.48 Da Isoelectric Point: 4.4986
>T275084 WP_024121091.1 NZ_CP120511:c1382676-1381930 [Bacillus sp. B28]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y3 |