Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 522235..522871 | Replicon | chromosome |
Accession | NZ_CP120511 | ||
Organism | Bacillus sp. B28 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P3L57_RS02675 | Protein ID | WP_003156187.1 |
Coordinates | 522521..522871 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P3L57_RS02670 | Protein ID | WP_003225183.1 |
Coordinates | 522235..522516 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3L57_RS02650 (P3L57_02650) | 518592..519191 | - | 600 | WP_024120294.1 | rhomboid family intramembrane serine protease | - |
P3L57_RS02655 (P3L57_02655) | 519286..519651 | + | 366 | WP_069487530.1 | holo-ACP synthase | - |
P3L57_RS02660 (P3L57_02660) | 519817..520833 | + | 1017 | WP_082687822.1 | outer membrane lipoprotein carrier protein LolA | - |
P3L57_RS02665 (P3L57_02665) | 520950..522119 | + | 1170 | WP_044161733.1 | alanine racemase | - |
P3L57_RS02670 (P3L57_02670) | 522235..522516 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P3L57_RS02675 (P3L57_02675) | 522521..522871 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P3L57_RS02680 (P3L57_02680) | 522989..523813 | + | 825 | WP_082687807.1 | RsbT co-antagonist protein RsbRA | - |
P3L57_RS02685 (P3L57_02685) | 523818..524183 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P3L57_RS02690 (P3L57_02690) | 524187..524588 | + | 402 | WP_024714447.1 | serine/threonine-protein kinase RsbT | - |
P3L57_RS02695 (P3L57_02695) | 524600..525607 | + | 1008 | WP_044161721.1 | phosphoserine phosphatase RsbU | - |
P3L57_RS02700 (P3L57_02700) | 525668..525997 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
P3L57_RS02705 (P3L57_02705) | 525994..526476 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
P3L57_RS02710 (P3L57_02710) | 526442..527230 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
P3L57_RS02715 (P3L57_02715) | 527230..527829 | + | 600 | WP_044161719.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275083 WP_003156187.1 NZ_CP120511:522521-522871 [Bacillus sp. B28]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|