Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yoeB-relB/YoeB-RelB |
Location | 2603146..2603669 | Replicon | chromosome |
Accession | NZ_CP120508 | ||
Organism | Paraburkholderia sp. SUR17 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | - |
Locus tag | P2869_RS11355 | Protein ID | WP_042303647.1 |
Coordinates | 2603146..2603412 (-) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | P2869_RS11360 | Protein ID | WP_042303648.1 |
Coordinates | 2603409..2603669 (-) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2869_RS11335 (P2869_11335) | 2598300..2599811 | - | 1512 | WP_277596512.1 | FGGY-family carbohydrate kinase | - |
P2869_RS11340 (P2869_11340) | 2600026..2601768 | + | 1743 | WP_277596513.1 | glycerol-3-phosphate dehydrogenase/oxidase | - |
P2869_RS11345 (P2869_11345) | 2601765..2602547 | + | 783 | WP_277596514.1 | GntR family transcriptional regulator | - |
P2869_RS11350 (P2869_11350) | 2602590..2602955 | + | 366 | Protein_2237 | IS5/IS1182 family transposase | - |
P2869_RS11355 (P2869_11355) | 2603146..2603412 | - | 267 | WP_042303647.1 | Txe/YoeB family addiction module toxin | Toxin |
P2869_RS11360 (P2869_11360) | 2603409..2603669 | - | 261 | WP_042303648.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
P2869_RS11365 (P2869_11365) | 2604439..2604705 | + | 267 | WP_277598120.1 | hypothetical protein | - |
P2869_RS11370 (P2869_11370) | 2604876..2607446 | - | 2571 | WP_277596515.1 | DUF2309 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2603146..2616836 | 13690 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10461.86 Da Isoelectric Point: 7.9846
>T275082 WP_042303647.1 NZ_CP120508:c2603412-2603146 [Paraburkholderia sp. SUR17]
MSGALNIMWTAEAWDDYVYWQGQDKRTLKRINQLIKDMQRSPFEGIGKPESLKENLTGFWSRRIDETNRLVYEVASTQIN
IVSCRYHY
MSGALNIMWTAEAWDDYVYWQGQDKRTLKRINQLIKDMQRSPFEGIGKPESLKENLTGFWSRRIDETNRLVYEVASTQIN
IVSCRYHY
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|