Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 11867..12396 | Replicon | chromosome |
Accession | NZ_CP120426 | ||
Organism | Staphylococcus epidermidis strain 25FSE01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | P5W78_RS00060 | Protein ID | WP_001829891.1 |
Coordinates | 11867..12229 (-) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | P5W78_RS00065 | Protein ID | WP_001829931.1 |
Coordinates | 12226..12396 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5W78_RS00040 | 8869..9639 | - | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
P5W78_RS00045 | 9614..10093 | - | 480 | WP_002484520.1 | anti-sigma B factor RsbW | - |
P5W78_RS00050 | 10095..10421 | - | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
P5W78_RS00055 | 10521..11522 | - | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
P5W78_RS00060 | 11867..12229 | - | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P5W78_RS00065 | 12226..12396 | - | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P5W78_RS00070 | 12483..13631 | - | 1149 | WP_218085223.1 | alanine racemase | - |
P5W78_RS00075 | 13697..14050 | - | 354 | WP_001829915.1 | holo-ACP synthase | - |
P5W78_RS00080 | 14098..14607 | - | 510 | WP_001829888.1 | PH domain-containing protein | - |
P5W78_RS00085 | 14594..16099 | - | 1506 | WP_001829976.1 | PH domain-containing protein | - |
P5W78_RS00090 | 16092..16571 | - | 480 | WP_001829909.1 | PH domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T275078 WP_001829891.1 NZ_CP120426:c12229-11867 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |