Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 2203534..2204063 | Replicon | chromosome |
Accession | NZ_CP120425 | ||
Organism | Staphylococcus epidermidis strain 25DSE01 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | P5W76_RS10535 | Protein ID | WP_001829891.1 |
Coordinates | 2203701..2204063 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | P5W76_RS10530 | Protein ID | WP_001829931.1 |
Coordinates | 2203534..2203704 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5W76_RS10505 | 2199359..2199838 | + | 480 | WP_001829909.1 | PH domain-containing protein | - |
P5W76_RS10510 | 2199831..2201336 | + | 1506 | WP_001829976.1 | PH domain-containing protein | - |
P5W76_RS10515 | 2201323..2201832 | + | 510 | WP_001829888.1 | PH domain-containing protein | - |
P5W76_RS10520 | 2201880..2202233 | + | 354 | WP_001829915.1 | holo-ACP synthase | - |
P5W76_RS10525 | 2202299..2203447 | + | 1149 | WP_002468951.1 | alanine racemase | - |
P5W76_RS10530 | 2203534..2203704 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P5W76_RS10535 | 2203701..2204063 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P5W76_RS10540 | 2204409..2205410 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
P5W76_RS10545 | 2205510..2205836 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
P5W76_RS10550 | 2205838..2206317 | + | 480 | WP_002484520.1 | anti-sigma B factor RsbW | - |
P5W76_RS10555 | 2206292..2207062 | + | 771 | WP_002468952.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T275076 WP_001829891.1 NZ_CP120425:2203701-2204063 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |