Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 805610..806080 Replicon chromosome
Accession NZ_CP120425
Organism Staphylococcus epidermidis strain 25DSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag P5W76_RS03800 Protein ID WP_001829569.1
Coordinates 805892..806080 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag P5W76_RS03795 Protein ID WP_002438963.1
Coordinates 805610..805867 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5W76_RS03755 800974..801690 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
P5W76_RS03760 801851..802273 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
P5W76_RS03765 802457..802612 - 156 WP_001829648.1 hypothetical protein -
P5W76_RS03770 802624..802811 - 188 Protein_748 hypothetical protein -
P5W76_RS03775 803198..803698 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
P5W76_RS03780 803969..804556 - 588 WP_001829615.1 histidine phosphatase family protein -
P5W76_RS03785 804770..805006 + 237 WP_002457224.1 hypothetical protein -
P5W76_RS03790 804998..805201 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
P5W76_RS03795 805610..805867 + 258 WP_002438963.1 hypothetical protein Antitoxin
P5W76_RS03800 805892..806080 + 189 WP_001829569.1 hypothetical protein Toxin
P5W76_RS03805 806270..806824 + 555 WP_001829566.1 lipoprotein N-acylation protein LnsA -
P5W76_RS03810 806884..807117 - 234 WP_001829664.1 hypothetical protein -
P5W76_RS03815 807401..808147 + 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
P5W76_RS03820 808246..808530 + 285 WP_001829635.1 hypothetical protein -
P5W76_RS03825 808554..808778 + 225 WP_001829613.1 hypothetical protein -
P5W76_RS03830 809399..809599 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 796582..820865 24283
- flank IS/Tn - - 802457..802612 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T275074 WP_001829569.1 NZ_CP120425:805892-806080 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT275074 WP_002438963.1 NZ_CP120425:805610-805867 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References