Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 2099422..2099892 Replicon chromosome
Accession NZ_CP120424
Organism Staphylococcus epidermidis strain 32FSE06

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag P5W77_RS09915 Protein ID WP_001829569.1
Coordinates 2099704..2099892 (+) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag P5W77_RS09910 Protein ID WP_002438963.1
Coordinates 2099422..2099679 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5W77_RS09870 2094788..2095504 - 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -
P5W77_RS09875 2095665..2096087 + 423 WP_002457221.1 organic hydroperoxide resistance protein -
P5W77_RS09880 2096271..2096408 - 138 WP_162161215.1 hypothetical protein -
P5W77_RS09885 2096438..2096625 - 188 Protein_1910 hypothetical protein -
P5W77_RS09890 2097012..2097512 + 501 WP_001829623.1 GNAT family N-acetyltransferase -
P5W77_RS09895 2097783..2098370 - 588 WP_001829615.1 histidine phosphatase family protein -
P5W77_RS09900 2098582..2098818 + 237 WP_002457224.1 hypothetical protein -
P5W77_RS09905 2098810..2099013 - 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
P5W77_RS09910 2099422..2099679 + 258 WP_002438963.1 hypothetical protein Antitoxin
P5W77_RS09915 2099704..2099892 + 189 WP_001829569.1 hypothetical protein Toxin
P5W77_RS09920 2100082..2100635 + 554 Protein_1917 hypothetical protein -
P5W77_RS09925 2100695..2100928 - 234 WP_001829664.1 hypothetical protein -
P5W77_RS09930 2101212..2101958 + 747 WP_002495246.1 poly-gamma-glutamate hydrolase family protein -
P5W77_RS09935 2102057..2102341 + 285 WP_001829635.1 hypothetical protein -
P5W77_RS09940 2102365..2102589 + 225 WP_001829613.1 hypothetical protein -
P5W77_RS09945 2103210..2103410 - 201 WP_001829681.1 cold-shock protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2096271..2132188 35917


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T275073 WP_001829569.1 NZ_CP120424:2099704-2099892 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT275073 WP_002438963.1 NZ_CP120424:2099422-2099679 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References