Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 965300..965829 | Replicon | chromosome |
Accession | NZ_CP120424 | ||
Organism | Staphylococcus epidermidis strain 32FSE06 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q5HME7 |
Locus tag | P5W77_RS04465 | Protein ID | WP_001829891.1 |
Coordinates | 965467..965829 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q5HME6 |
Locus tag | P5W77_RS04460 | Protein ID | WP_001829931.1 |
Coordinates | 965300..965470 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5W77_RS04435 | 961126..961605 | + | 480 | WP_002457111.1 | PH domain-containing protein | - |
P5W77_RS04440 | 961598..963103 | + | 1506 | WP_002457110.1 | PH domain-containing protein | - |
P5W77_RS04445 | 963090..963599 | + | 510 | WP_002457109.1 | PH domain-containing protein | - |
P5W77_RS04450 | 963647..964000 | + | 354 | WP_002457108.1 | holo-ACP synthase | - |
P5W77_RS04455 | 964065..965213 | + | 1149 | WP_002457107.1 | alanine racemase | - |
P5W77_RS04460 | 965300..965470 | + | 171 | WP_001829931.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P5W77_RS04465 | 965467..965829 | + | 363 | WP_001829891.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
P5W77_RS04470 | 966174..967175 | + | 1002 | WP_001829902.1 | PP2C family protein-serine/threonine phosphatase | - |
P5W77_RS04475 | 967275..967601 | + | 327 | WP_001829952.1 | anti-sigma factor antagonist | - |
P5W77_RS04480 | 967603..968082 | + | 480 | WP_001829903.1 | anti-sigma B factor RsbW | - |
P5W77_RS04485 | 968057..968827 | + | 771 | WP_002440602.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13497.65 Da Isoelectric Point: 9.9522
>T275071 WP_001829891.1 NZ_CP120424:965467-965829 [Staphylococcus epidermidis]
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
MIRRGDVYLADLSPVQGSEQGGVRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKKKYKLDKDSVILLEQIR
TLDKKRLKEKLTFLSESKMIEVDNALDISLGLNNFDHHKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2G7HWR0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0N1EF65 |