275068

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TsaAT/-
Location 1391998..1392468 Replicon chromosome
Accession NZ_CP120423
Organism Staphylococcus epidermidis strain 41DSE01

Toxin (Protein)


Gene name TsaT Uniprot ID Q5HQS5
Locus tag P5W75_RS06505 Protein ID WP_001829569.1
Coordinates 1391998..1392186 (-) Length 63 a.a.

Antitoxin (Protein)


Gene name TsaA Uniprot ID D4FNP2
Locus tag P5W75_RS06510 Protein ID WP_002438963.1
Coordinates 1392211..1392468 (-) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5W75_RS06475 1388479..1388679 + 201 WP_001829681.1 cold-shock protein -
P5W75_RS06480 1389300..1389524 - 225 WP_001829613.1 hypothetical protein -
P5W75_RS06485 1389548..1389832 - 285 WP_001829635.1 hypothetical protein -
P5W75_RS06490 1389931..1390677 - 747 WP_002438959.1 poly-gamma-glutamate hydrolase family protein -
P5W75_RS06495 1390961..1391194 + 234 WP_001829664.1 hypothetical protein -
P5W75_RS06500 1391254..1391808 - 555 WP_218085209.1 lipoprotein N-acylation protein LnsA -
P5W75_RS06505 1391998..1392186 - 189 WP_001829569.1 hypothetical protein Toxin
P5W75_RS06510 1392211..1392468 - 258 WP_002438963.1 hypothetical protein Antitoxin
P5W75_RS06515 1392877..1393080 + 204 WP_002438966.1 sterile alpha motif-like domain-containing protein -
P5W75_RS06520 1393072..1393308 - 237 WP_002457224.1 hypothetical protein -
P5W75_RS06525 1393522..1394109 + 588 WP_001829615.1 histidine phosphatase family protein -
P5W75_RS06530 1394380..1394880 - 501 WP_001829623.1 GNAT family N-acetyltransferase -
P5W75_RS06535 1395267..1395454 + 188 Protein_1266 hypothetical protein -
P5W75_RS06540 1395484..1395621 + 138 WP_162161215.1 hypothetical protein -
P5W75_RS06545 1395805..1396227 - 423 WP_002457221.1 organic hydroperoxide resistance protein -
P5W75_RS06550 1396388..1397104 + 717 WP_001831974.1 type I 3-dehydroquinate dehydratase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1395466..1395621 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 63 a.a.        Molecular weight: 7229.94 Da        Isoelectric Point: 9.7844

>T275068 WP_001829569.1 NZ_CP120423:c1392186-1391998 [Staphylococcus epidermidis]
MSLHFQILLWLSILFIIAGTILLVTMLKTKKEERKESYLGFTVIFLIFGFAILIYTFIFGIL

Download         Length: 189 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 10014.05 Da        Isoelectric Point: 4.5440

>AT275068 WP_002438963.1 NZ_CP120423:c1392468-1392211 [Staphylococcus epidermidis]
MKLNKANIFNLIFTILFFSFNILITYNANIDYKLWLIPGLAICGFALFSSLTLVIIYSDLFSEILFFINIILALYYIYPI
FYEFV

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0N0LUH8

Antitoxin

Source ID Structure
AlphaFold DB A0A0U5IVM3

References