Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 42901..44038 | Replicon | plasmid pBN62-65kb |
Accession | NZ_CP120418 | ||
Organism | Lactococcus sp. bn62 |
Toxin (Protein)
Gene name | zeta | Uniprot ID | P0A4M2 |
Locus tag | P3G65_RS11390 | Protein ID | WP_002332783.1 |
Coordinates | 43175..44038 (+) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | Q9AL19 |
Locus tag | P3G65_RS11385 | Protein ID | WP_002326825.1 |
Coordinates | 42901..43173 (+) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3G65_RS11355 | 39963..40153 | + | 191 | Protein_44 | peptide-binding protein | - |
P3G65_RS11360 | 40202..40285 | + | 84 | WP_032501549.1 | 23S rRNA methyltransferase attenuator leader peptide ErmL | - |
P3G65_RS11365 | 40410..41147 | + | 738 | WP_001038790.1 | 23S rRNA (adenine(2058)-N(6))-methyltransferase Erm(B) | - |
P3G65_RS11370 | 41317..41577 | + | 261 | Protein_47 | topoisomerase DNA-binding C4 zinc finger domain-containing protein | - |
P3G65_RS11375 | 41680..42576 | + | 897 | WP_002326827.1 | ParA family protein | - |
P3G65_RS11380 | 42668..42883 | + | 216 | WP_001835296.1 | peptide-binding protein | - |
P3G65_RS11385 | 42901..43173 | + | 273 | WP_002326825.1 | antitoxin | Antitoxin |
P3G65_RS11390 | 43175..44038 | + | 864 | WP_002332783.1 | zeta toxin family protein | Toxin |
P3G65_RS11395 | 44478..44795 | + | 318 | WP_002326830.1 | hypothetical protein | - |
P3G65_RS11400 | 45092..45589 | + | 498 | WP_000868795.1 | trimethoprim-resistant dihydrofolate reductase DfrG | - |
P3G65_RS11405 | 45661..46545 | - | 885 | Protein_54 | insertion element protein | - |
P3G65_RS11410 | 46591..47271 | - | 681 | WP_001015311.1 | IS6-like element IS1216 family transposase | - |
P3G65_RS11415 | 47469..47780 | + | 312 | Protein_56 | replication initiation protein | - |
P3G65_RS11420 | 47915..48562 | + | 648 | WP_002295562.1 | type A chloramphenicol O-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / dfrG / cat | - | 1..65460 | 65460 | |
- | inside | IScluster/Tn | erm(B) / dfrG / cat | - | 36417..49504 | 13087 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32675.27 Da Isoelectric Point: 7.3939
>T275065 WP_002332783.1 NZ_CP120418:43175-44038 [Lactococcus sp. bn62]
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANITDFTEKQFEDRLEKNVERLTKNRLAVESPTAFLLGGQPGSGKTSLRSAISEETQGNVVIIDNDTFKQQHPNFDELV
KLYEKDVVKYVTPYSNRMTEAIISRLRDKGYNLVIEGTGRTTDVPIQTATMLQAKDYETKMYVMAVPKINSYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | P0A4M2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2AF93 |