Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4680225..4680841 Replicon chromosome
Accession NZ_CP120399
Organism Salmonella enterica subsp. enterica serovar Typhi strain 314-2017_CO_03

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag PVA79_RS23035 Protein ID WP_000238494.1
Coordinates 4680225..4680599 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PVA79_RS23040 Protein ID WP_001523745.1
Coordinates 4680599..4680841 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVA79_RS23020 (PVA79_23015) 4677727..4678629 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
PVA79_RS23025 (PVA79_23020) 4678626..4679261 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PVA79_RS23030 (PVA79_23025) 4679258..4680187 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
PVA79_RS23035 (PVA79_23030) 4680225..4680599 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
PVA79_RS23040 (PVA79_23035) 4680599..4680841 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PVA79_RS23045 (PVA79_23040) 4681046..4681975 + 930 WP_001162859.1 alpha/beta hydrolase -
PVA79_RS23050 (PVA79_23045) 4682061..4682372 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
PVA79_RS23055 (PVA79_23050) 4682369..4682815 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
PVA79_RS23060 (PVA79_23055) 4682830..4683771 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PVA79_RS23065 (PVA79_23060) 4683816..4684253 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
PVA79_RS23070 (PVA79_23065) 4684250..4685122 - 873 WP_000921423.1 virulence factor BrkB family protein -
PVA79_RS23075 (PVA79_23070) 4685116..4685715 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T275063 WP_000238494.1 NZ_CP120399:c4680599-4680225 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT275063 WP_001523745.1 NZ_CP120399:c4680841-4680599 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References