Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3327985..3328605 | Replicon | chromosome |
Accession | NZ_CP120399 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 314-2017_CO_03 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PVA79_RS16500 | Protein ID | WP_001280991.1 |
Coordinates | 3328387..3328605 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PVA79_RS16495 | Protein ID | WP_000344807.1 |
Coordinates | 3327985..3328359 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA79_RS16485 (PVA79_16485) | 3323124..3324317 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PVA79_RS16490 (PVA79_16490) | 3324340..3327489 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
PVA79_RS16495 (PVA79_16495) | 3327985..3328359 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PVA79_RS16500 (PVA79_16500) | 3328387..3328605 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PVA79_RS16505 (PVA79_16505) | 3328784..3329335 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PVA79_RS16510 (PVA79_16510) | 3329453..3329923 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PVA79_RS16515 (PVA79_16515) | 3329979..3330119 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PVA79_RS16520 (PVA79_16520) | 3330125..3330385 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PVA79_RS16525 (PVA79_16525) | 3330610..3332160 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
PVA79_RS16535 (PVA79_16535) | 3332391..3332780 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PVA79_RS16540 (PVA79_16540) | 3332813..3333382 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275058 WP_001280991.1 NZ_CP120399:3328387-3328605 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275058 WP_000344807.1 NZ_CP120399:3327985-3328359 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|