Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 822225..822850 | Replicon | chromosome |
Accession | NZ_CP120399 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 314-2017_CO_03 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PVA79_RS04005 | Protein ID | WP_000911334.1 |
Coordinates | 822452..822850 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PVA79_RS04000 | Protein ID | WP_000557549.1 |
Coordinates | 822225..822452 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA79_RS03970 (PVA79_03970) | 817396..818115 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
PVA79_RS03975 (PVA79_03975) | 818119..818322 | + | 204 | WP_000184036.1 | hypothetical protein | - |
PVA79_RS03980 (PVA79_03980) | 818405..818860 | + | 456 | WP_223229661.1 | hypothetical protein | - |
PVA79_RS03985 (PVA79_03985) | 818962..820083 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
PVA79_RS03990 (PVA79_03990) | 820716..821522 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
PVA79_RS03995 (PVA79_03995) | 821797..822048 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PVA79_RS04000 (PVA79_04000) | 822225..822452 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PVA79_RS04005 (PVA79_04005) | 822452..822850 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PVA79_RS04010 (PVA79_04010) | 823657..824193 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PVA79_RS04015 (PVA79_04015) | 824240..824872 | + | 633 | WP_000835268.1 | YfdX family protein | - |
PVA79_RS04020 (PVA79_04020) | 825591..826172 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 815154..831295 | 16141 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T275052 WP_000911334.1 NZ_CP120399:822452-822850 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|