Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4006303..4006819 | Replicon | chromosome |
Accession | NZ_CP120398 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 424-2019_CI |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | PVA85_RS19720 | Protein ID | WP_000220578.1 |
Coordinates | 4006303..4006587 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PVA85_RS19725 | Protein ID | WP_000212724.1 |
Coordinates | 4006577..4006819 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA85_RS19705 (PVA85_19700) | 4001515..4003167 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
PVA85_RS19710 (PVA85_19705) | 4003576..4005714 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PVA85_RS19715 (PVA85_19710) | 4005835..4006299 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PVA85_RS19720 (PVA85_19715) | 4006303..4006587 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVA85_RS19725 (PVA85_19720) | 4006577..4006819 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PVA85_RS19730 (PVA85_19725) | 4006897..4008810 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
PVA85_RS19735 (PVA85_19730) | 4008827..4009567 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
PVA85_RS19740 (PVA85_19735) | 4009564..4010682 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PVA85_RS19745 (PVA85_19740) | 4010666..4011799 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T275045 WP_000220578.1 NZ_CP120398:c4006587-4006303 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |