Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4596549..4597165 Replicon chromosome
Accession NZ_CP120397
Organism Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag PVA76_RS22645 Protein ID WP_000238494.1
Coordinates 4596549..4596923 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PVA76_RS22650 Protein ID WP_001523745.1
Coordinates 4596923..4597165 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVA76_RS22630 (PVA76_22625) 4594051..4594953 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
PVA76_RS22635 (PVA76_22630) 4594950..4595585 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PVA76_RS22640 (PVA76_22635) 4595582..4596511 + 930 WP_057492927.1 formate dehydrogenase accessory protein FdhE -
PVA76_RS22645 (PVA76_22640) 4596549..4596923 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
PVA76_RS22650 (PVA76_22645) 4596923..4597165 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PVA76_RS22655 (PVA76_22650) 4597370..4598299 + 930 WP_001162859.1 alpha/beta hydrolase -
PVA76_RS22660 (PVA76_22655) 4598385..4598696 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
PVA76_RS22665 (PVA76_22660) 4598693..4599139 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
PVA76_RS22670 (PVA76_22665) 4599154..4600095 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PVA76_RS22675 (PVA76_22670) 4600140..4600577 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
PVA76_RS22680 (PVA76_22675) 4600574..4601446 - 873 WP_285238944.1 virulence factor BrkB family protein -
PVA76_RS22685 (PVA76_22680) 4601440..4602039 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T275033 WP_000238494.1 NZ_CP120397:c4596923-4596549 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT275033 WP_001523745.1 NZ_CP120397:c4597165-4596923 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References