Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3964721..3965237 | Replicon | chromosome |
| Accession | NZ_CP120397 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PVA76_RS19445 | Protein ID | WP_000220578.1 |
| Coordinates | 3964721..3965005 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PVA76_RS19450 | Protein ID | WP_000212724.1 |
| Coordinates | 3964995..3965237 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA76_RS19430 (PVA76_19425) | 3959933..3961585 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
| PVA76_RS19435 (PVA76_19430) | 3961994..3964132 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PVA76_RS19440 (PVA76_19435) | 3964253..3964717 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PVA76_RS19445 (PVA76_19440) | 3964721..3965005 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVA76_RS19450 (PVA76_19445) | 3964995..3965237 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PVA76_RS19455 (PVA76_19450) | 3965315..3967228 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
| PVA76_RS19460 (PVA76_19455) | 3967245..3967985 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
| PVA76_RS19465 (PVA76_19460) | 3967982..3969100 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PVA76_RS19470 (PVA76_19465) | 3969084..3970217 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T275031 WP_000220578.1 NZ_CP120397:c3965005-3964721 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |