Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1367783..1368403 | Replicon | chromosome |
| Accession | NZ_CP120397 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | PVA76_RS06550 | Protein ID | WP_001280991.1 |
| Coordinates | 1367783..1368001 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | PVA76_RS06555 | Protein ID | WP_000344807.1 |
| Coordinates | 1368029..1368403 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA76_RS06510 (PVA76_06510) | 1363006..1363575 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
| PVA76_RS06515 (PVA76_06515) | 1363608..1363997 | - | 390 | WP_000961285.1 | MGMT family protein | - |
| PVA76_RS06525 (PVA76_06525) | 1364228..1365778 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
| PVA76_RS06530 (PVA76_06530) | 1366003..1366263 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| PVA76_RS06535 (PVA76_06535) | 1366269..1366409 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| PVA76_RS06540 (PVA76_06540) | 1366465..1366935 | - | 471 | WP_000136183.1 | YlaC family protein | - |
| PVA76_RS06545 (PVA76_06545) | 1367053..1367604 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| PVA76_RS06550 (PVA76_06550) | 1367783..1368001 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| PVA76_RS06555 (PVA76_06555) | 1368029..1368403 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| PVA76_RS06560 (PVA76_06560) | 1368899..1372048 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
| PVA76_RS06565 (PVA76_06565) | 1372071..1373264 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T275025 WP_001280991.1 NZ_CP120397:c1368001-1367783 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT275025 WP_000344807.1 NZ_CP120397:c1368403-1368029 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|