Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 799616..800241 | Replicon | chromosome |
Accession | NZ_CP120397 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PVA76_RS03800 | Protein ID | WP_000911334.1 |
Coordinates | 799843..800241 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PVA76_RS03795 | Protein ID | WP_000557549.1 |
Coordinates | 799616..799843 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA76_RS03765 (PVA76_03765) | 794787..795506 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
PVA76_RS03770 (PVA76_03770) | 795510..795713 | + | 204 | WP_000184036.1 | hypothetical protein | - |
PVA76_RS03775 (PVA76_03775) | 795796..796251 | + | 456 | WP_223229661.1 | hypothetical protein | - |
PVA76_RS03780 (PVA76_03780) | 796353..797474 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
PVA76_RS03785 (PVA76_03785) | 798107..798913 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
PVA76_RS03790 (PVA76_03790) | 799188..799439 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PVA76_RS03795 (PVA76_03795) | 799616..799843 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PVA76_RS03800 (PVA76_03800) | 799843..800241 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PVA76_RS03805 (PVA76_03805) | 801048..801584 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PVA76_RS03810 (PVA76_03810) | 801631..802263 | + | 633 | WP_000835268.1 | YfdX family protein | - |
PVA76_RS03815 (PVA76_03815) | 802982..803563 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T275023 WP_000911334.1 NZ_CP120397:799843-800241 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|