Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 646376..647211 | Replicon | chromosome |
| Accession | NZ_CP120397 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | PVA76_RS03005 | Protein ID | WP_057492839.1 |
| Coordinates | 646376..646753 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | PVA76_RS03010 | Protein ID | WP_057492837.1 |
| Coordinates | 646843..647211 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA76_RS02960 (PVA76_02960) | 641612..642103 | + | 492 | WP_000626103.1 | GNAT family N-acetyltransferase | - |
| PVA76_RS02965 (PVA76_02965) | 642344..643096 | - | 753 | WP_001785756.1 | non-specific acid phosphatase | - |
| PVA76_RS02970 (PVA76_02970) | 643196..643273 | - | 78 | Protein_578 | porin family protein | - |
| PVA76_RS02975 (PVA76_02975) | 643671..643727 | + | 57 | WP_285238976.1 | helix-turn-helix domain-containing protein | - |
| PVA76_RS02980 (PVA76_02980) | 644073..644399 | - | 327 | WP_001546501.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| PVA76_RS02985 (PVA76_02985) | 644396..644659 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| PVA76_RS02990 (PVA76_02990) | 644731..645597 | - | 867 | WP_057492841.1 | DUF4942 domain-containing protein | - |
| PVA76_RS02995 (PVA76_02995) | 645682..645924 | - | 243 | WP_072195452.1 | DUF957 domain-containing protein | - |
| PVA76_RS03000 (PVA76_03000) | 645891..646379 | - | 489 | WP_001546482.1 | DUF5983 family protein | - |
| PVA76_RS03005 (PVA76_03005) | 646376..646753 | - | 378 | WP_057492839.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| PVA76_RS03010 (PVA76_03010) | 646843..647211 | - | 369 | WP_057492837.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| PVA76_RS03015 (PVA76_03015) | 647291..647512 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
| PVA76_RS03020 (PVA76_03020) | 647581..648057 | - | 477 | WP_057492835.1 | RadC family protein | - |
| PVA76_RS03025 (PVA76_03025) | 648073..648558 | - | 486 | WP_057492833.1 | antirestriction protein | - |
| PVA76_RS03030 (PVA76_03030) | 648650..649468 | - | 819 | WP_057492831.1 | DUF932 domain-containing protein | - |
| PVA76_RS03035 (PVA76_03035) | 649558..649708 | - | 151 | Protein_591 | DUF905 family protein | - |
| PVA76_RS03040 (PVA76_03040) | 649834..650370 | - | 537 | WP_047628209.1 | DUF4234 domain-containing protein | - |
| PVA76_RS03045 (PVA76_03045) | 650433..651734 | - | 1302 | WP_170989464.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 639358..665435 | 26077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13972.98 Da Isoelectric Point: 7.8839
>T275021 WP_057492839.1 NZ_CP120397:c646753-646376 [Salmonella enterica subsp. enterica serovar Typhi]
MKTLPVLPEQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPVLPEQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13657.40 Da Isoelectric Point: 6.4768
>AT275021 WP_057492837.1 NZ_CP120397:c647211-646843 [Salmonella enterica subsp. enterica serovar Typhi]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|