Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 641322..642103 Replicon chromosome
Accession NZ_CP120397
Organism Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CI

Toxin (Protein)


Gene name TacT2 Uniprot ID Q8Z1M4
Locus tag PVA76_RS02960 Protein ID WP_000626103.1
Coordinates 641612..642103 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name TacA2 Uniprot ID Q8Z1M5
Locus tag PVA76_RS02955 Protein ID WP_001110456.1
Coordinates 641322..641615 (+) Length 98 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVA76_RS02925 (PVA76_02925) 637575..638480 + 906 WP_001268195.1 YjiK family protein -
PVA76_RS02930 (PVA76_02930) 638767..639111 - 345 WP_100680417.1 Ig-like domain-containing protein -
PVA76_RS02935 (PVA76_02935) 639119..639335 - 217 Protein_571 hypothetical protein -
PVA76_RS02940 (PVA76_02940) 639358..639645 - 288 WP_001269916.1 transcriptional regulator RtsB -
PVA76_RS02945 (PVA76_02945) 639642..640517 - 876 WP_000921674.1 AraC family transcriptional regulator -
PVA76_RS02950 (PVA76_02950) 640783..641005 - 223 Protein_574 hypothetical protein -
PVA76_RS02955 (PVA76_02955) 641322..641615 + 294 WP_001110456.1 DUF1778 domain-containing protein Antitoxin
PVA76_RS02960 (PVA76_02960) 641612..642103 + 492 WP_000626103.1 GNAT family N-acetyltransferase Toxin
PVA76_RS02965 (PVA76_02965) 642344..643096 - 753 WP_001785756.1 non-specific acid phosphatase -
PVA76_RS02970 (PVA76_02970) 643196..643273 - 78 Protein_578 porin family protein -
PVA76_RS02975 (PVA76_02975) 643671..643727 + 57 WP_285238976.1 helix-turn-helix domain-containing protein -
PVA76_RS02980 (PVA76_02980) 644073..644399 - 327 WP_001546501.1 type II toxin-antitoxin system RelE/ParE family toxin -
PVA76_RS02985 (PVA76_02985) 644396..644659 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PVA76_RS02990 (PVA76_02990) 644731..645597 - 867 WP_057492841.1 DUF4942 domain-containing protein -
PVA76_RS02995 (PVA76_02995) 645682..645924 - 243 WP_072195452.1 DUF957 domain-containing protein -
PVA76_RS03000 (PVA76_03000) 645891..646379 - 489 WP_001546482.1 DUF5983 family protein -
PVA76_RS03005 (PVA76_03005) 646376..646753 - 378 WP_057492839.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 639358..665435 26077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(85-145)

Antitoxin

Vibrio phage ICP1, Orf50

(14-88)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17675.47 Da        Isoelectric Point: 7.2652

>T275020 WP_000626103.1 NZ_CP120397:641612-642103 [Salmonella enterica subsp. enterica serovar Typhi]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQWVGFVPSPMDPMMLMVTLGDLV
ESV

Download         Length: 492 bp

Antitoxin


Download         Length: 98 a.a.        Molecular weight: 11005.67 Da        Isoelectric Point: 8.6141

>AT275020 WP_001110456.1 NZ_CP120397:641322-641615 [Salmonella enterica subsp. enterica serovar Typhi]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEVLIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK

Download         Length: 294 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A718CB38

Antitoxin

Source ID Structure
AlphaFold DB A0A716NSU2

References