Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 646376..647211 Replicon chromosome
Accession NZ_CP120396
Organism Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CO_04

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag PVA80_RS03000 Protein ID WP_057492839.1
Coordinates 646376..646753 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag PVA80_RS03005 Protein ID WP_057492837.1
Coordinates 646843..647211 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVA80_RS02955 (PVA80_02955) 641612..642103 + 492 WP_000626103.1 GNAT family N-acetyltransferase -
PVA80_RS02960 (PVA80_02960) 642344..643096 - 753 WP_001785756.1 non-specific acid phosphatase -
PVA80_RS02965 (PVA80_02965) 643196..643273 - 78 Protein_577 porin family protein -
PVA80_RS02970 (PVA80_02970) 643671..643727 + 57 WP_285238976.1 helix-turn-helix domain-containing protein -
PVA80_RS02975 (PVA80_02975) 644073..644399 - 327 WP_001546501.1 type II toxin-antitoxin system RelE/ParE family toxin -
PVA80_RS02980 (PVA80_02980) 644396..644659 - 264 WP_001143297.1 type II toxin-antitoxin system ParD family antitoxin -
PVA80_RS02985 (PVA80_02985) 644731..645597 - 867 WP_057492841.1 DUF4942 domain-containing protein -
PVA80_RS02990 (PVA80_02990) 645682..645924 - 243 WP_072195452.1 DUF957 domain-containing protein -
PVA80_RS02995 (PVA80_02995) 645891..646379 - 489 WP_001546482.1 DUF5983 family protein -
PVA80_RS03000 (PVA80_03000) 646376..646753 - 378 WP_057492839.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
PVA80_RS03005 (PVA80_03005) 646843..647211 - 369 WP_057492837.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
PVA80_RS03010 (PVA80_03010) 647291..647512 - 222 WP_000692303.1 DUF987 domain-containing protein -
PVA80_RS03015 (PVA80_03015) 647581..648057 - 477 WP_057492835.1 RadC family protein -
PVA80_RS03020 (PVA80_03020) 648073..648558 - 486 WP_057492833.1 antirestriction protein -
PVA80_RS03025 (PVA80_03025) 648650..649468 - 819 WP_057492831.1 DUF932 domain-containing protein -
PVA80_RS03030 (PVA80_03030) 649558..649708 - 151 Protein_590 DUF905 family protein -
PVA80_RS03035 (PVA80_03035) 649834..650370 - 537 WP_047628209.1 DUF4234 domain-containing protein -
PVA80_RS03040 (PVA80_03040) 650433..651734 - 1302 WP_170989464.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 639358..665435 26077


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13972.98 Da        Isoelectric Point: 7.8839

>T275005 WP_057492839.1 NZ_CP120396:c646753-646376 [Salmonella enterica subsp. enterica serovar Typhi]
MKTLPVLPEQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13657.40 Da        Isoelectric Point: 6.4768

>AT275005 WP_057492837.1 NZ_CP120396:c647211-646843 [Salmonella enterica subsp. enterica serovar Typhi]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References