Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 641322..642103 | Replicon | chromosome |
Accession | NZ_CP120396 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1521-2017_CO_04 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8Z1M4 |
Locus tag | PVA80_RS02955 | Protein ID | WP_000626103.1 |
Coordinates | 641612..642103 (+) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8Z1M5 |
Locus tag | PVA80_RS02950 | Protein ID | WP_001110456.1 |
Coordinates | 641322..641615 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA80_RS02920 (PVA80_02920) | 637575..638480 | + | 906 | WP_001268195.1 | YjiK family protein | - |
PVA80_RS02925 (PVA80_02925) | 638767..639111 | - | 345 | WP_100680417.1 | Ig-like domain-containing protein | - |
PVA80_RS02930 (PVA80_02930) | 639119..639335 | - | 217 | Protein_570 | hypothetical protein | - |
PVA80_RS02935 (PVA80_02935) | 639358..639645 | - | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
PVA80_RS02940 (PVA80_02940) | 639642..640517 | - | 876 | WP_000921674.1 | AraC family transcriptional regulator | - |
PVA80_RS02945 (PVA80_02945) | 640783..641005 | - | 223 | Protein_573 | hypothetical protein | - |
PVA80_RS02950 (PVA80_02950) | 641322..641615 | + | 294 | WP_001110456.1 | DUF1778 domain-containing protein | Antitoxin |
PVA80_RS02955 (PVA80_02955) | 641612..642103 | + | 492 | WP_000626103.1 | GNAT family N-acetyltransferase | Toxin |
PVA80_RS02960 (PVA80_02960) | 642344..643096 | - | 753 | WP_001785756.1 | non-specific acid phosphatase | - |
PVA80_RS02965 (PVA80_02965) | 643196..643273 | - | 78 | Protein_577 | porin family protein | - |
PVA80_RS02970 (PVA80_02970) | 643671..643727 | + | 57 | WP_285238976.1 | helix-turn-helix domain-containing protein | - |
PVA80_RS02975 (PVA80_02975) | 644073..644399 | - | 327 | WP_001546501.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PVA80_RS02980 (PVA80_02980) | 644396..644659 | - | 264 | WP_001143297.1 | type II toxin-antitoxin system ParD family antitoxin | - |
PVA80_RS02985 (PVA80_02985) | 644731..645597 | - | 867 | WP_057492841.1 | DUF4942 domain-containing protein | - |
PVA80_RS02990 (PVA80_02990) | 645682..645924 | - | 243 | WP_072195452.1 | DUF957 domain-containing protein | - |
PVA80_RS02995 (PVA80_02995) | 645891..646379 | - | 489 | WP_001546482.1 | DUF5983 family protein | - |
PVA80_RS03000 (PVA80_03000) | 646376..646753 | - | 378 | WP_057492839.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 639358..665435 | 26077 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17675.47 Da Isoelectric Point: 7.2652
>T275004 WP_000626103.1 NZ_CP120396:641612-642103 [Salmonella enterica subsp. enterica serovar Typhi]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQWVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQWVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 11005.67 Da Isoelectric Point: 8.6141
>AT275004 WP_001110456.1 NZ_CP120396:641322-641615 [Salmonella enterica subsp. enterica serovar Typhi]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEVLIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEVLIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A718CB38 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A716NSU2 |