Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1(toxin)
Location 4676090..4676706 Replicon chromosome
Accession NZ_CP120395
Organism Salmonella enterica subsp. enterica serovar Typhi strain 1698-2017_CI

Toxin (Protein)


Gene name vapC Uniprot ID Q8Z2U3
Locus tag PVA70_RS23160 Protein ID WP_000238494.1
Coordinates 4676090..4676464 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8E9YHE9
Locus tag PVA70_RS23165 Protein ID WP_001523745.1
Coordinates 4676464..4676706 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PVA70_RS23145 (PVA70_23145) 4673592..4674494 + 903 WP_000331359.1 formate dehydrogenase subunit beta -
PVA70_RS23150 (PVA70_23150) 4674491..4675126 + 636 WP_000829025.1 formate dehydrogenase cytochrome b556 subunit -
PVA70_RS23155 (PVA70_23155) 4675123..4676052 + 930 WP_000027727.1 formate dehydrogenase accessory protein FdhE -
PVA70_RS23160 (PVA70_23160) 4676090..4676464 - 375 WP_000238494.1 type II toxin-antitoxin system VapC family toxin Toxin
PVA70_RS23165 (PVA70_23165) 4676464..4676706 - 243 WP_001523745.1 CopG family transcriptional regulator Antitoxin
PVA70_RS23170 (PVA70_23170) 4676911..4677840 + 930 WP_001162859.1 alpha/beta hydrolase -
PVA70_RS23175 (PVA70_23175) 4677926..4678237 + 312 WP_000558160.1 type II toxin-antitoxin system HigB family toxin -
PVA70_RS23180 (PVA70_23180) 4678234..4678680 + 447 WP_001259009.1 type II toxin-antitoxin system HigA family antitoxin -
PVA70_RS23185 (PVA70_23185) 4678695..4679636 - 942 WP_001518251.1 fatty acid biosynthesis protein FabY -
PVA70_RS23190 (PVA70_23190) 4679681..4680118 - 438 WP_000560975.1 D-aminoacyl-tRNA deacylase -
PVA70_RS23195 (PVA70_23195) 4680115..4680987 - 873 WP_000921423.1 virulence factor BrkB family protein -
PVA70_RS23200 (PVA70_23200) 4680981..4681580 - 600 WP_000965695.1 glucose-1-phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(7-115)

Antitoxin

Ribbon-helix-helix protein, CopG

(13-47)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13908.18 Da        Isoelectric Point: 7.3567

>T275001 WP_000238494.1 NZ_CP120395:c4676464-4676090 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL

Download         Length: 375 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9437.77 Da        Isoelectric Point: 4.4463

>AT275001 WP_001523745.1 NZ_CP120395:c4676706-4676464 [Salmonella enterica subsp. enterica serovar Typhi]
MMAGMDMGRILLDLSDDVIKRLDDLKVQRNLPRAELLREAVEQYLERQDRAETTISKALGLWQGCEEDGVEYQRKLREEW

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5I6CND8

Antitoxin

Source ID Structure

References