Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4006424..4006940 | Replicon | chromosome |
| Accession | NZ_CP120395 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1698-2017_CI | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | C0Q7A9 |
| Locus tag | PVA70_RS19805 | Protein ID | WP_000220578.1 |
| Coordinates | 4006424..4006708 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | PVA70_RS19810 | Protein ID | WP_000212724.1 |
| Coordinates | 4006698..4006940 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA70_RS19790 (PVA70_19785) | 4001636..4003288 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
| PVA70_RS19795 (PVA70_19790) | 4003697..4005835 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| PVA70_RS19800 (PVA70_19795) | 4005956..4006420 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| PVA70_RS19805 (PVA70_19800) | 4006424..4006708 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PVA70_RS19810 (PVA70_19805) | 4006698..4006940 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| PVA70_RS19815 (PVA70_19810) | 4007018..4008931 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
| PVA70_RS19820 (PVA70_19815) | 4008948..4009688 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
| PVA70_RS19825 (PVA70_19820) | 4009685..4010803 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| PVA70_RS19830 (PVA70_19825) | 4010787..4011920 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274998 WP_000220578.1 NZ_CP120395:c4006708-4006424 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E876 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |