Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 836231..836856 | Replicon | chromosome |
| Accession | NZ_CP120395 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1698-2017_CI | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PVA70_RS04130 | Protein ID | WP_000911334.1 |
| Coordinates | 836458..836856 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | PVA70_RS04125 | Protein ID | WP_000557549.1 |
| Coordinates | 836231..836458 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA70_RS04095 (PVA70_04095) | 831402..832121 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
| PVA70_RS04100 (PVA70_04100) | 832125..832328 | + | 204 | WP_000184036.1 | hypothetical protein | - |
| PVA70_RS04105 (PVA70_04105) | 832411..832866 | + | 456 | WP_223229661.1 | hypothetical protein | - |
| PVA70_RS04110 (PVA70_04110) | 832968..834089 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
| PVA70_RS04115 (PVA70_04115) | 834722..835528 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
| PVA70_RS04120 (PVA70_04120) | 835803..836054 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| PVA70_RS04125 (PVA70_04125) | 836231..836458 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PVA70_RS04130 (PVA70_04130) | 836458..836856 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PVA70_RS04135 (PVA70_04135) | 837663..838199 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| PVA70_RS04140 (PVA70_04140) | 838246..838878 | + | 633 | WP_000835268.1 | YfdX family protein | - |
| PVA70_RS04145 (PVA70_04145) | 839597..840178 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 816200..846761 | 30561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T274990 WP_000911334.1 NZ_CP120395:836458-836856 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|