Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4636160..4636776 | Replicon | chromosome |
| Accession | NZ_CP120394 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CI | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q8Z2U3 |
| Locus tag | PVA73_RS22905 | Protein ID | WP_000238494.1 |
| Coordinates | 4636160..4636534 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8E9YHE9 |
| Locus tag | PVA73_RS22910 | Protein ID | WP_001523745.1 |
| Coordinates | 4636534..4636776 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA73_RS22890 (PVA73_22885) | 4633662..4634564 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PVA73_RS22895 (PVA73_22890) | 4634561..4635196 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVA73_RS22900 (PVA73_22895) | 4635193..4636122 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PVA73_RS22905 (PVA73_22900) | 4636160..4636534 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PVA73_RS22910 (PVA73_22905) | 4636534..4636776 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | Antitoxin |
| PVA73_RS22915 (PVA73_22910) | 4636981..4637910 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PVA73_RS22920 (PVA73_22915) | 4637996..4638307 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | - |
| PVA73_RS22925 (PVA73_22920) | 4638304..4638750 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PVA73_RS22930 (PVA73_22925) | 4638765..4639706 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PVA73_RS22935 (PVA73_22930) | 4639751..4640188 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PVA73_RS22940 (PVA73_22935) | 4640185..4641057 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PVA73_RS22945 (PVA73_22940) | 4641051..4641650 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13908.18 Da Isoelectric Point: 7.3567
>T274986 WP_000238494.1 NZ_CP120394:c4636534-4636160 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|