Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1388705..1389325 | Replicon | chromosome |
Accession | NZ_CP120394 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CI |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PVA73_RS06775 | Protein ID | WP_001280991.1 |
Coordinates | 1388705..1388923 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PVA73_RS06780 | Protein ID | WP_000344807.1 |
Coordinates | 1388951..1389325 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA73_RS06735 (PVA73_06735) | 1383928..1384497 | + | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
PVA73_RS06740 (PVA73_06740) | 1384530..1384919 | - | 390 | WP_000961285.1 | MGMT family protein | - |
PVA73_RS06750 (PVA73_06750) | 1385150..1386700 | - | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
PVA73_RS06755 (PVA73_06755) | 1386925..1387185 | + | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PVA73_RS06760 (PVA73_06760) | 1387191..1387331 | + | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PVA73_RS06765 (PVA73_06765) | 1387387..1387857 | - | 471 | WP_000136183.1 | YlaC family protein | - |
PVA73_RS06770 (PVA73_06770) | 1387975..1388526 | - | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PVA73_RS06775 (PVA73_06775) | 1388705..1388923 | - | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PVA73_RS06780 (PVA73_06780) | 1388951..1389325 | - | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PVA73_RS06785 (PVA73_06785) | 1389821..1392970 | - | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
PVA73_RS06790 (PVA73_06790) | 1392993..1394186 | - | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274977 WP_001280991.1 NZ_CP120394:c1388923-1388705 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274977 WP_000344807.1 NZ_CP120394:c1389325-1388951 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|