Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 820510..821135 | Replicon | chromosome |
| Accession | NZ_CP120394 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CI | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PVA73_RS04030 | Protein ID | WP_000911334.1 |
| Coordinates | 820737..821135 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | M7S3S8 |
| Locus tag | PVA73_RS04025 | Protein ID | WP_000557549.1 |
| Coordinates | 820510..820737 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA73_RS03995 (PVA73_03995) | 815681..816400 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
| PVA73_RS04000 (PVA73_04000) | 816404..816607 | + | 204 | WP_000184036.1 | hypothetical protein | - |
| PVA73_RS04005 (PVA73_04005) | 816690..817145 | + | 456 | WP_223229661.1 | hypothetical protein | - |
| PVA73_RS04010 (PVA73_04010) | 817247..818368 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
| PVA73_RS04015 (PVA73_04015) | 819001..819807 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
| PVA73_RS04020 (PVA73_04020) | 820082..820333 | - | 252 | WP_001540858.1 | hypothetical protein | - |
| PVA73_RS04025 (PVA73_04025) | 820510..820737 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PVA73_RS04030 (PVA73_04030) | 820737..821135 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PVA73_RS04035 (PVA73_04035) | 821942..822478 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
| PVA73_RS04040 (PVA73_04040) | 822525..823157 | + | 633 | WP_000835268.1 | YfdX family protein | - |
| PVA73_RS04045 (PVA73_04045) | 823876..824457 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 813429..829580 | 16151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T274975 WP_000911334.1 NZ_CP120394:820737-821135 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|