Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 4675982..4676598 | Replicon | chromosome |
| Accession | NZ_CP120393 | ||
| Organism | Salmonella enterica subsp. enterica serovar Typhi strain 1698-2017_CO_06 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q8Z2U3 |
| Locus tag | PVA83_RS23050 | Protein ID | WP_000238494.1 |
| Coordinates | 4675982..4676356 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8E9YHE9 |
| Locus tag | PVA83_RS23055 | Protein ID | WP_001523745.1 |
| Coordinates | 4676356..4676598 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVA83_RS23035 (PVA83_23035) | 4673484..4674386 | + | 903 | WP_000331359.1 | formate dehydrogenase subunit beta | - |
| PVA83_RS23040 (PVA83_23040) | 4674383..4675018 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PVA83_RS23045 (PVA83_23045) | 4675015..4675944 | + | 930 | WP_000027727.1 | formate dehydrogenase accessory protein FdhE | - |
| PVA83_RS23050 (PVA83_23050) | 4675982..4676356 | - | 375 | WP_000238494.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PVA83_RS23055 (PVA83_23055) | 4676356..4676598 | - | 243 | WP_001523745.1 | CopG family transcriptional regulator | Antitoxin |
| PVA83_RS23060 (PVA83_23060) | 4676803..4677732 | + | 930 | WP_001162859.1 | alpha/beta hydrolase | - |
| PVA83_RS23065 (PVA83_23065) | 4677818..4678129 | + | 312 | WP_000558160.1 | type II toxin-antitoxin system HigB family toxin | - |
| PVA83_RS23070 (PVA83_23070) | 4678126..4678572 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | - |
| PVA83_RS23075 (PVA83_23075) | 4678587..4679528 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PVA83_RS23080 (PVA83_23080) | 4679573..4680010 | - | 438 | WP_000560975.1 | D-aminoacyl-tRNA deacylase | - |
| PVA83_RS23085 (PVA83_23085) | 4680007..4680879 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PVA83_RS23090 (PVA83_23090) | 4680873..4681472 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13908.18 Da Isoelectric Point: 7.3567
>T274971 WP_000238494.1 NZ_CP120393:c4676356-4675982 [Salmonella enterica subsp. enterica serovar Typhi]
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
MVKGSALFDTNILIDLFSGRIEAKHALEAYPPQNAISLITWMEVMVGAKKYHQENRTRIALSAFNIIGVTQEIAERSVIV
RQEYGMKLPDAIILATAQVHRCELVTRNTKDFADIPGVITPYHL
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|