Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4008588..4009104 | Replicon | chromosome |
Accession | NZ_CP120392 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CO_04_Copr1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | C0Q7A9 |
Locus tag | PVA84_RS19770 | Protein ID | WP_000220578.1 |
Coordinates | 4008588..4008872 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | V7ISI8 |
Locus tag | PVA84_RS19775 | Protein ID | WP_000212724.1 |
Coordinates | 4008862..4009104 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA84_RS19755 (PVA84_19750) | 4003800..4005452 | + | 1653 | WP_000155051.1 | alpha,alpha-phosphotrehalase | - |
PVA84_RS19760 (PVA84_19755) | 4005861..4007999 | + | 2139 | WP_000187820.1 | anaerobic ribonucleoside-triphosphate reductase | - |
PVA84_RS19765 (PVA84_19760) | 4008120..4008584 | + | 465 | WP_001268860.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
PVA84_RS19770 (PVA84_19765) | 4008588..4008872 | - | 285 | WP_000220578.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PVA84_RS19775 (PVA84_19770) | 4008862..4009104 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PVA84_RS19780 (PVA84_19775) | 4009182..4011095 | - | 1914 | WP_001212152.1 | BglG family transcription antiterminator | - |
PVA84_RS19785 (PVA84_19780) | 4011112..4011852 | - | 741 | WP_000779260.1 | KDGP aldolase family protein | - |
PVA84_RS19790 (PVA84_19785) | 4011849..4012967 | - | 1119 | WP_001139189.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
PVA84_RS19795 (PVA84_19790) | 4012951..4014084 | - | 1134 | WP_000459938.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10854.67 Da Isoelectric Point: 10.0482
>T274953 WP_000220578.1 NZ_CP120392:c4008872-4008588 [Salmonella enterica subsp. enterica serovar Typhi]
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNGLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3Z1E876 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H5JRI5 |