Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3326236..3326856 | Replicon | chromosome |
Accession | NZ_CP120392 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CO_04_Copr1 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | PVA84_RS16575 | Protein ID | WP_001280991.1 |
Coordinates | 3326638..3326856 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | PVA84_RS16570 | Protein ID | WP_000344807.1 |
Coordinates | 3326236..3326610 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA84_RS16560 (PVA84_16560) | 3321375..3322568 | + | 1194 | WP_001039199.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PVA84_RS16565 (PVA84_16565) | 3322591..3325740 | + | 3150 | WP_001132507.1 | efflux RND transporter permease AcrB | - |
PVA84_RS16570 (PVA84_16570) | 3326236..3326610 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
PVA84_RS16575 (PVA84_16575) | 3326638..3326856 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
PVA84_RS16580 (PVA84_16580) | 3327035..3327586 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
PVA84_RS16585 (PVA84_16585) | 3327704..3328174 | + | 471 | WP_000136183.1 | YlaC family protein | - |
PVA84_RS16590 (PVA84_16590) | 3328230..3328370 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
PVA84_RS16595 (PVA84_16595) | 3328376..3328636 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
PVA84_RS16600 (PVA84_16600) | 3328861..3330411 | + | 1551 | WP_000213129.1 | EAL domain-containing protein | - |
PVA84_RS16610 (PVA84_16610) | 3330642..3331031 | + | 390 | WP_000961285.1 | MGMT family protein | - |
PVA84_RS16615 (PVA84_16615) | 3331064..3331633 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T274951 WP_001280991.1 NZ_CP120392:3326638-3326856 [Salmonella enterica subsp. enterica serovar Typhi]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT274951 WP_000344807.1 NZ_CP120392:3326236-3326610 [Salmonella enterica subsp. enterica serovar Typhi]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|