Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 820509..821134 | Replicon | chromosome |
Accession | NZ_CP120392 | ||
Organism | Salmonella enterica subsp. enterica serovar Typhi strain 2027-2019_CO_04_Copr1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | PVA84_RS04030 | Protein ID | WP_000911334.1 |
Coordinates | 820736..821134 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | M7S3S8 |
Locus tag | PVA84_RS04025 | Protein ID | WP_000557549.1 |
Coordinates | 820509..820736 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PVA84_RS03995 (PVA84_03995) | 815680..816399 | + | 720 | WP_000082599.1 | Rha family transcriptional regulator | - |
PVA84_RS04000 (PVA84_04000) | 816403..816606 | + | 204 | WP_000184036.1 | hypothetical protein | - |
PVA84_RS04005 (PVA84_04005) | 816689..817144 | + | 456 | WP_223229661.1 | hypothetical protein | - |
PVA84_RS04010 (PVA84_04010) | 817246..818367 | + | 1122 | WP_000028980.1 | hypothetical protein | - |
PVA84_RS04015 (PVA84_04015) | 819000..819806 | - | 807 | WP_077905073.1 | DUF1460 domain-containing protein | - |
PVA84_RS04020 (PVA84_04020) | 820081..820332 | - | 252 | WP_001540858.1 | hypothetical protein | - |
PVA84_RS04025 (PVA84_04025) | 820509..820736 | + | 228 | WP_000557549.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PVA84_RS04030 (PVA84_04030) | 820736..821134 | + | 399 | WP_000911334.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
PVA84_RS04035 (PVA84_04035) | 821941..822477 | + | 537 | WP_001038500.1 | STM3031 family outer membrane protein | - |
PVA84_RS04040 (PVA84_04040) | 822524..823156 | + | 633 | WP_000835268.1 | YfdX family protein | - |
PVA84_RS04045 (PVA84_04045) | 823875..824456 | + | 582 | WP_001244646.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 813428..829579 | 16151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15091.44 Da Isoelectric Point: 7.7785
>T274945 WP_000911334.1 NZ_CP120392:820736-821134 [Salmonella enterica subsp. enterica serovar Typhi]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNFAVVEGFISRLEVLDYDTQAAIHT
GQIRTELARKGTPVGSYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|