Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 1009395..1009988 | Replicon | chromosome |
Accession | NZ_CP120377 | ||
Organism | Pseudomonas sp. G11 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | P2T68_RS04480 | Protein ID | WP_102625774.1 |
Coordinates | 1009686..1009988 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A855JY32 |
Locus tag | P2T68_RS04475 | Protein ID | WP_024073150.1 |
Coordinates | 1009395..1009682 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P2T68_RS04455 (P2T68_04455) | 1005798..1007867 | - | 2070 | WP_024073146.1 | TonB-dependent copper receptor | - |
P2T68_RS04460 (P2T68_04460) | 1007960..1008361 | - | 402 | WP_024073147.1 | DUF2946 domain-containing protein | - |
P2T68_RS04465 (P2T68_04465) | 1008372..1008854 | - | 483 | WP_168232253.1 | copper chaperone PCu(A)C | - |
P2T68_RS04470 (P2T68_04470) | 1008902..1009297 | - | 396 | WP_102625775.1 | DUF2946 domain-containing protein | - |
P2T68_RS04475 (P2T68_04475) | 1009395..1009682 | - | 288 | WP_024073150.1 | putative addiction module antidote protein | Antitoxin |
P2T68_RS04480 (P2T68_04480) | 1009686..1009988 | - | 303 | WP_102625774.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P2T68_RS04485 (P2T68_04485) | 1010506..1010760 | + | 255 | WP_024073152.1 | DUF6124 family protein | - |
P2T68_RS04490 (P2T68_04490) | 1010804..1011127 | - | 324 | WP_024073153.1 | transcriptional regulator | - |
P2T68_RS04495 (P2T68_04495) | 1011133..1011465 | - | 333 | WP_024073154.1 | addiction module protein | - |
P2T68_RS04500 (P2T68_04500) | 1011522..1012247 | - | 726 | WP_024073155.1 | cobalt-precorrin-6A reductase | - |
P2T68_RS04505 (P2T68_04505) | 1012244..1013449 | - | 1206 | WP_277379096.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
P2T68_RS04510 (P2T68_04510) | 1013545..1014834 | + | 1290 | WP_227496844.1 | precorrin-3B synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11775.50 Da Isoelectric Point: 10.0002
>T274942 WP_102625774.1 NZ_CP120377:c1009988-1009686 [Pseudomonas sp. G11]
MIQFKKSKHFLEWLDSLRSKPARARVLARLDHAQWGNFGDCEALGNGVFEMRIHYGPGYRVYFTRRDEVVYLLLIGGDKS
TQKRDIQRAKQIAEDFEKKE
MIQFKKSKHFLEWLDSLRSKPARARVLARLDHAQWGNFGDCEALGNGVFEMRIHYGPGYRVYFTRRDEVVYLLLIGGDKS
TQKRDIQRAKQIAEDFEKKE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|