Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/- |
Location | 5864540..5865136 | Replicon | chromosome |
Accession | NZ_CP120376 | ||
Organism | Pseudomonas nitroreducens strain L4 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | - |
Locus tag | P3T65_RS26895 | Protein ID | WP_277368790.1 |
Coordinates | 5864540..5864881 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | - |
Locus tag | P3T65_RS26900 | Protein ID | WP_277368791.1 |
Coordinates | 5864888..5865136 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P3T65_RS26860 (P3T65_26860) | 5860417..5861181 | - | 765 | WP_065085981.1 | RES family NAD+ phosphorylase | - |
P3T65_RS26865 (P3T65_26865) | 5861182..5861550 | - | 369 | WP_024763405.1 | DUF2384 domain-containing protein | - |
P3T65_RS26870 (P3T65_26870) | 5861820..5862311 | + | 492 | WP_065085982.1 | RcnB family protein | - |
P3T65_RS26875 (P3T65_26875) | 5862318..5862749 | - | 432 | WP_024763403.1 | hypothetical protein | - |
P3T65_RS26880 (P3T65_26880) | 5862874..5863356 | + | 483 | WP_065085983.1 | GreA/GreB family elongation factor | - |
P3T65_RS26885 (P3T65_26885) | 5863490..5863837 | + | 348 | WP_017522075.1 | carboxymuconolactone decarboxylase family protein | - |
P3T65_RS26890 (P3T65_26890) | 5863937..5864305 | + | 369 | WP_024763401.1 | hypothetical protein | - |
P3T65_RS26895 (P3T65_26895) | 5864540..5864881 | - | 342 | WP_277368790.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P3T65_RS26900 (P3T65_26900) | 5864888..5865136 | - | 249 | WP_277368791.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P3T65_RS26905 (P3T65_26905) | 5865237..5866511 | - | 1275 | WP_277368792.1 | hypothetical protein | - |
P3T65_RS26910 (P3T65_26910) | 5866753..5868042 | - | 1290 | WP_277368793.1 | zonular occludens toxin domain-containing protein | - |
P3T65_RS26915 (P3T65_26915) | 5868046..5868402 | - | 357 | WP_054909843.1 | DUF2523 family protein | - |
P3T65_RS26920 (P3T65_26920) | 5868406..5869689 | - | 1284 | WP_277368794.1 | attachment protein | - |
P3T65_RS26925 (P3T65_26925) | 5869840..5870079 | - | 240 | WP_024763395.1 | major capsid protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13045.79 Da Isoelectric Point: 4.6115
>T274941 WP_277368790.1 NZ_CP120376:c5864881-5864540 [Pseudomonas nitroreducens]
MTVREIRFTETAVFSIQDQEEHLAEYHPPELAAVKIDGLIDEILTRLQNAPVGYPVSRQATDLGVTRYRELNHDGYRVFY
EVYEHDNVIAVELVLRQKQDVEAALIRYCLVGI
MTVREIRFTETAVFSIQDQEEHLAEYHPPELAAVKIDGLIDEILTRLQNAPVGYPVSRQATDLGVTRYRELNHDGYRVFY
EVYEHDNVIAVELVLRQKQDVEAALIRYCLVGI
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|